Lineage for d5llsb2 (5lls B:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153236Species Pig (Sus scrofa) [TaxId:9823] [226476] (2 PDB entries)
  8. 2153239Domain d5llsb2: 5lls B:509-766 [322809]
    Other proteins in same PDB: d5llsa1, d5llsb1, d5llsc1, d5llsd1
    automated match to d1orva2
    complexed with 6z8, nag, so4

Details for d5llsb2

PDB Entry: 5lls (more details), 2.41 Å

PDB Description: porcine dipeptidyl peptidase iv in complex with 8-(3-aminopiperidin-1- yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1h- purine-2,6-dione
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5llsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llsb2 c.69.1.0 (B:509-766) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOPe Domain Coordinates for d5llsb2:

Click to download the PDB-style file with coordinates for d5llsb2.
(The format of our PDB-style files is described here.)

Timeline for d5llsb2: