SCOPe 2.06: Domain d5llsd1: 5lls D:40-508

Lineage for d5llsd1 (5lls D:40-508)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (3 species)
   not a true protein

7. Species Sus scrofa [TaxId:9823] [322689] (1 PDB entry)

8. Domain d5llsd1: 5lls D:40-508 [322761]
   Other proteins in same PDB: d5llsa2, d5llsb2, d5llsc2, d5llsd2
   automated match to d1orva1
   complexed with 6z8, nag, so4

Details for d5llsd1

PDB Entry: 5lls, 2.41 Å

PDB Description: porcine dipeptidyl peptidase iv in complex with 8-(3-aminopiperidin-1- yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1h- purine-2,6-dione

PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5llsd1:

Sequence; same for both SEQRES and ATOM records:

>d5llsd1 b.70.3.1 (D:40-508) automated matches {Sus scrofa [TaxId: 9823]}
rrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdelg
ystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitwsp
vghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlspn
asvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwis
svarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfitk
gawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyysa
sfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

Timeline for d5llsd1:

• d5llsd1 is new in SCOPe 2.06-stable
  
• d5llsd1 appears in SCOPe 2.07
  
• d5llsd1 appears in the current release, SCOPe 2.08