Lineage for d1ftsa2 (1fts A:285-495)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111919Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 2111920Species Escherichia coli [TaxId:562] [52667] (2 PDB entries)
  8. 2111922Domain d1ftsa2: 1fts A:285-495 [32279]
    Other proteins in same PDB: d1ftsa1

Details for d1ftsa2

PDB Entry: 1fts (more details), 2.2 Å

PDB Description: signal recognition particle receptor from e. coli
PDB Compounds: (A:) ftsy

SCOPe Domain Sequences for d1ftsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftsa2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

SCOPe Domain Coordinates for d1ftsa2:

Click to download the PDB-style file with coordinates for d1ftsa2.
(The format of our PDB-style files is described here.)

Timeline for d1ftsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ftsa1