Lineage for d5ixsa1 (5ixs A:1-159)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2452768Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)
  8. 2452849Domain d5ixsa1: 5ixs A:1-159 [322592]
    Other proteins in same PDB: d5ixsa2, d5ixsb2, d5ixsc2, d5ixsd2
    automated match to d1i10d1
    complexed with 6ey, epe, nai, so4, txd

Details for d5ixsa1

PDB Entry: 5ixs (more details), 2.05 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 9: (6r)-3-[(2-chlorophenyl)sulfanyl]-4-hydroxy-6-(3-hydroxyphenyl)-6- (thiophen-3-yl)-5,6-dihydropyridin-2(1h)-one
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixsa1:

Sequence, based on SEQRES records: (download)

>d5ixsa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d5ixsa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqsrlnlvqrnvnifkfiipnvv
kyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5ixsa1:

Click to download the PDB-style file with coordinates for d5ixsa1.
(The format of our PDB-style files is described here.)

Timeline for d5ixsa1: