SCOPe 2.07: Domain d5ixsd2: 5ixs D:160-331

Lineage for d5ixsd2 (5ixs D:160-331)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (38 PDB entries)

8. Domain d5ixsd2: 5ixs D:160-331 [322587]
   Other proteins in same PDB: d5ixsa1, d5ixsb1, d5ixsc1, d5ixsd1
   automated match to d1i10d2
   complexed with 6ey, epe, nai, so4, txd

Details for d5ixsd2

PDB Entry: 5ixs, 2.05 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 9: (6r)-3-[(2-chlorophenyl)sulfanyl]-4-hydroxy-6-(3-hydroxyphenyl)-6- (thiophen-3-yl)-5,6-dihydropyridin-2(1h)-one

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixsd2:

Sequence; same for both SEQRES and ATOM records:

>d5ixsd2 d.162.1.1 (D:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d5ixsd2:

• d5ixsd2 first appeared in SCOPe 2.06
  
• d5ixsd2 appears in the current release, SCOPe 2.08