SCOPe 2.08: Domain d5htgb_: 5htg B:

Lineage for d5htgb_ (5htg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [322564] (6 PDB entries)

8. Domain d5htgb_: 5htg B: [322570]
   automated match to d4iq2a_

Details for d5htgb_

PDB Entry: 5htg, 2.4 Å

PDB Description: structure of apo p1 form of candida albicans fkbp12

PDB Compounds: (B:) FK506-binding protein 1

SCOPe Domain Sequences for d5htgb_:

Sequence; same for both SEQRES and ATOM records:

>d5htgb_ d.26.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
gq

Timeline for d5htgb_:

• d5htgb_ first appeared in SCOPe 2.06
  
• d5htgb_ appears in SCOPe 2.07