PDB entry 5htg

View 5htg on RCSB PDB site
Description: Structure of apo P1 form of Candida albicans FKBP12
Class: isomerase
Keywords: FKBP12, pathogenic fungi, calcineurin, ISOMERASE
Deposited on 2016-01-26, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 1
  Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
  Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28870 (0-121)
  Domains in SCOPe 2.08: d5htga_
• Chain 'B':
  Compound: FK506-binding protein 1
  Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
  Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28870 (0-121)
  Domains in SCOPe 2.08: d5htgb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5htgA (A:)
  eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
  wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
  gq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5htgB (B:)
  eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
  wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
  gq