Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (11 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [322520] (1 PDB entry) |
Domain d5fefa1: 5fef A:1-131 [322521] Other proteins in same PDB: d5fefa2 automated match to d1g5ua_ complexed with gol |
PDB Entry: 5fef (more details), 2.2 Å
SCOPe Domain Sequences for d5fefa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fefa1 d.110.1.1 (A:1-131) automated matches {Maize (Zea mays) [TaxId: 4577]} mswqayvddhllcdiegqhlsaaaivghdgsvwaqsenfpelkpeevagmikdfdepgtl aptglfvggtkymviqgepgvvirgkkgtggitikktgmsliigiydepmtpgqcnmvve rlgdylieqgf
Timeline for d5fefa1: