SCOPe 2.07: Domain d5fefa1: 5fef A:1-131

Lineage for d5fefa1 (5fef A:1-131)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
   automatically mapped to Pfam PF00235

6. Protein automated matches [190412] (11 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [322520] (1 PDB entry)

8. Domain d5fefa1: 5fef A:1-131 [322521]
   Other proteins in same PDB: d5fefa2
   automated match to d1g5ua_
   complexed with gol

Details for d5fefa1

PDB Entry: 5fef, 2.2 Å

PDB Description: crystal structure of the allergen profilin (zea m 12)

PDB Compounds: (A:) Profilin-5

SCOPe Domain Sequences for d5fefa1:

Sequence; same for both SEQRES and ATOM records:

>d5fefa1 d.110.1.1 (A:1-131) automated matches {Maize (Zea mays) [TaxId: 4577]}
mswqayvddhllcdiegqhlsaaaivghdgsvwaqsenfpelkpeevagmikdfdepgtl
aptglfvggtkymviqgepgvvirgkkgtggitikktgmsliigiydepmtpgqcnmvve
rlgdylieqgf

Timeline for d5fefa1:

• d5fefa1 first appeared in SCOPe 2.06
  
• d5fefa1 appears in the current release, SCOPe 2.08