Lineage for d5fefa1 (5fef A:1-131)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) 
alpha-beta(2)-alpha-beta(5)-alphaFamily d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
automatically mapped to Pfam PF00235Protein automated matches [190412] (11 species)
not a true protein
Species Maize (Zea mays) [TaxId:4577] [322520] (1 PDB entry) 
Domain d5fefa1: 5fef A:1-131 [322521]
Other proteins in same PDB: d5fefa2
automated match to d1g5ua_
complexed with gol
Details for d5fefa1
PDB Entry: 5fef (more details), 2.2 Å
PDB Description: crystal structure of the allergen profilin (zea m 12)
PDB Compounds: (A:) Profilin-5SCOPe Domain Sequences for d5fefa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fefa1 d.110.1.1 (A:1-131) automated matches {Maize (Zea mays) [TaxId: 4577]}
mswqayvddhllcdiegqhlsaaaivghdgsvwaqsenfpelkpeevagmikdfdepgtl
aptglfvggtkymviqgepgvvirgkkgtggitikktgmsliigiydepmtpgqcnmvve
rlgdylieqgf
SCOPe Domain Coordinates for d5fefa1:
Click to download the PDB-style file with coordinates for d5fefa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5fefa1:
- d5fefa1 first appeared in SCOPe 2.06
- d5fefa1 appears in SCOPe 2.07
View in 3D
