Lineage for d5fefa1 (5fef A:1-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970082Protein automated matches [190412] (11 species)
    not a true protein
  7. 2970107Species Maize (Zea mays) [TaxId:4577] [322520] (1 PDB entry)
  8. 2970108Domain d5fefa1: 5fef A:1-131 [322521]
    Other proteins in same PDB: d5fefa2
    automated match to d1g5ua_
    complexed with gol

Details for d5fefa1

PDB Entry: 5fef (more details), 2.2 Å

PDB Description: crystal structure of the allergen profilin (zea m 12)
PDB Compounds: (A:) Profilin-5

SCOPe Domain Sequences for d5fefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fefa1 d.110.1.1 (A:1-131) automated matches {Maize (Zea mays) [TaxId: 4577]}
mswqayvddhllcdiegqhlsaaaivghdgsvwaqsenfpelkpeevagmikdfdepgtl
aptglfvggtkymviqgepgvvirgkkgtggitikktgmsliigiydepmtpgqcnmvve
rlgdylieqgf

SCOPe Domain Coordinates for d5fefa1:

Click to download the PDB-style file with coordinates for d5fefa1.
(The format of our PDB-style files is described here.)

Timeline for d5fefa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fefa2