![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries) |
![]() | Domain d5k09m_: 5k09 M: [322206] Other proteins in same PDB: d5k09a2, d5k09g2, d5k09r2 automated match to d4pyna_ complexed with 6pq, k, po4 |
PDB Entry: 5k09 (more details), 2.7 Å
SCOPe Domain Sequences for d5k09m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k09m_ c.66.1.1 (M:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]} gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl vlelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqd lipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdfla yvrgsssfecthyssyleymkvvdglekaiyqgps
Timeline for d5k09m_:
![]() Domains from other chains: (mouse over for more information) d5k09a1, d5k09a2, d5k09b_, d5k09c_, d5k09d_, d5k09e_, d5k09f_, d5k09g1, d5k09g2, d5k09h_, d5k09i_, d5k09j_, d5k09k_, d5k09l_, d5k09n_, d5k09o_, d5k09p_, d5k09q_, d5k09r1, d5k09r2, d5k09s_, d5k09t_, d5k09u_, d5k09v_, d5k09w_, d5k09x_ |