SCOP 1.67: Domain d1hooa_: 1hoo A:

Lineage for d1hooa_ (1hoo A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
   common fold is interrupted by an all-alpha subdomain, residues 100-200

7. Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)

8. Domain d1hooa_: 1hoo A: [32217]

Details for d1hooa_

PDB Entry: 1hoo, 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from e. coli at ph 6.5 and 25 degrees celsius

SCOP Domain Sequences for d1hooa_:

Sequence; same for both SEQRES and ATOM records:

>d1hooa_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

Timeline for d1hooa_:

• d1hooa_ first appeared (with stable ids) in SCOP 1.55
  
• d1hooa_ appears in SCOP 1.65
  
• d1hooa_ appears in SCOP 1.69
  
• d1hooa_ appears in the current release, SCOPe 2.08