Lineage for d1hooa_ (1hoo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869014Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2869015Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)
  8. 2869023Domain d1hooa_: 1hoo A: [32217]
    complexed with gnh, gnp
    has additional subdomain(s) that are not in the common domain

Details for d1hooa_

PDB Entry: 1hoo (more details), 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from e. coli at ph 6.5 and 25 degrees celsius
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1hooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hooa_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOPe Domain Coordinates for d1hooa_:

Click to download the PDB-style file with coordinates for d1hooa_.
(The format of our PDB-style files is described here.)

Timeline for d1hooa_: