Lineage for d5jtqb_ (5jtq B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550149Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2550150Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2550181Family d.33.1.0: automated matches [321736] (1 protein)
    not a true family
  6. 2550182Protein automated matches [321737] (2 species)
    not a true protein
  7. 2550188Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries)
  8. 2550194Domain d5jtqb_: 5jtq B: [321779]
    automated match to d1fx3b_

Details for d5jtqb_

PDB Entry: 5jtq (more details)

PDB Description: the structure of chaperone secb in complex with unstructured mbp binding site d
PDB Compounds: (B:) protein-export protein secb

SCOPe Domain Sequences for d5jtqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtqb_ d.33.1.0 (B:) automated matches {Escherichia coli [TaxId: 83334]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda

SCOPe Domain Coordinates for d5jtqb_:

Click to download the PDB-style file with coordinates for d5jtqb_.
(The format of our PDB-style files is described here.)

Timeline for d5jtqb_: