Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
Superfamily d.33.1: SecB-like [54611] (3 families) |
Family d.33.1.0: automated matches [321736] (1 protein) not a true family |
Protein automated matches [321737] (2 species) not a true protein |
Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries) |
Domain d5jtqb_: 5jtq B: [321779] automated match to d1fx3b_ |
PDB Entry: 5jtq (more details)
SCOPe Domain Sequences for d5jtqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jtqb_ d.33.1.0 (B:) automated matches {Escherichia coli [TaxId: 83334]} mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr gtfpqlnlapvnfdalfmnylqqqagegteehqda
Timeline for d5jtqb_: