Lineage for d1fx3b_ (1fx3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943085Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
    automatically mapped to Pfam PF02556
  6. 2943086Protein Bacterial protein-export protein SecB [54613] (2 species)
  7. 2943092Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)
  8. 2943094Domain d1fx3b_: 1fx3 B: [38525]

Details for d1fx3b_

PDB Entry: 1fx3 (more details), 2.5 Å

PDB Description: crystal structure of h. influenzae secb
PDB Compounds: (B:) protein-export protein secb

SCOPe Domain Sequences for d1fx3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx3b_ d.33.1.1 (B:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]}
qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
lnlspvnfdalfveymnrqqaenaeekse

SCOPe Domain Coordinates for d1fx3b_:

Click to download the PDB-style file with coordinates for d1fx3b_.
(The format of our PDB-style files is described here.)

Timeline for d1fx3b_: