SCOPe 2.07: Domain d5lf7o_: 5lf7 O:

Lineage for d5lf7o_ (5lf7 O:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries)

8. Domain d5lf7o_: 5lf7 O: [321659]
   Other proteins in same PDB: d5lf7b_, d5lf7c_, d5lf7d_, d5lf7e_, d5lf7f_, d5lf7g_, d5lf7h_, d5lf7i_, d5lf7j_, d5lf7k_, d5lf7l_, d5lf7m_, d5lf7n_, d5lf7p_, d5lf7q_, d5lf7r_, d5lf7s_, d5lf7t_, d5lf7u_, d5lf7v_, d5lf7w_, d5lf7x_, d5lf7y_, d5lf7z_
   automated match to d1irub_
   complexed with 1pe, 6v8, cl, k, mg

Details for d5lf7o_

PDB Entry: 5lf7, 2 Å

PDB Description: human 20s proteasome complex with ixazomib at 2.0 angstrom

PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5lf7o_:

Sequence; same for both SEQRES and ATOM records:

>d5lf7o_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai

Timeline for d5lf7o_:

• d5lf7o_ first appeared in SCOPe 2.06
  
• d5lf7o_ appears in the current release, SCOPe 2.08