SCOPe 2.07: Domain d5lf3g_: 5lf3 G:

Lineage for d5lf3g_ (5lf3 G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311423] (24 PDB entries)

8. Domain d5lf3g_: 5lf3 G: [321583]
   Other proteins in same PDB: d5lf3a_, d5lf3b_, d5lf3c_, d5lf3e_, d5lf3f_, d5lf3i_, d5lf3k_, d5lf3l_, d5lf3m_, d5lf3n1, d5lf3n2, d5lf3o_, d5lf3p_, d5lf3q_, d5lf3s_, d5lf3t_, d5lf3w_, d5lf3y_, d5lf3z_
   automated match to d1irua_
   complexed with 1pe, bo2, cl, k, mg

Details for d5lf3g_

PDB Entry: 5lf3, 2.1 Å

PDB Description: human 20s proteasome complex with bortezomib at 2.1 angstrom

PDB Compounds: (G:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5lf3g_:

Sequence; same for both SEQRES and ATOM records:

>d5lf3g_ d.153.1.4 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
laer

Timeline for d5lf3g_:

• d5lf3g_ first appeared in SCOPe 2.06
  
• d5lf3g_ appears in the current release, SCOPe 2.08