![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain [52639] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52640] (2 PDB entries) |
![]() | Domain d1dg3a2: 1dg3 A:6-283 [32153] Other proteins in same PDB: d1dg3a1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1dg3 (more details), 1.8 Å
SCOPe Domain Sequences for d1dg3a2:
Sequence, based on SEQRES records: (download)
>d1dg3a2 c.37.1.8 (A:6-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgf slgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsst fvynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvwtlrdf sldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrr klaqleklqdeeldpefvqqvadfcsyifsnsktktls
>d1dg3a2 c.37.1.8 (A:6-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} hmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkhtk giwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstfvynsigtinq qamdqlyyvtelthrirsksdsadfvsffpdfvwtlrdfsldlqpltpdeyltyslklkk gtsqkdetfnlprlcirkffpkkkcfvfdrpvheldpefvqqvadfcsyifsnsktktls
Timeline for d1dg3a2: