Lineage for d5lexg_ (5lex G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2229896Species Human (Homo sapiens) [TaxId:9606] [311423] (8 PDB entries)
  8. 2229942Domain d5lexg_: 5lex G: [321480]
    Other proteins in same PDB: d5lexa_, d5lexb_, d5lexc_, d5lexe_, d5lexf_, d5lexi_, d5lexk_, d5lexl_, d5lexm_, d5lexn_, d5lexo_, d5lexp_, d5lexq_, d5lexs_, d5lext_, d5lexw_, d5lexy_, d5lexz_
    automated match to d1irua_
    complexed with 1pe, k, mg

Details for d5lexg_

PDB Entry: 5lex (more details), 2.2 Å

PDB Description: native human 20s proteasome in mg-acetate at 2.2 angstrom
PDB Compounds: (G:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5lexg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lexg_ d.153.1.4 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
laer

SCOPe Domain Coordinates for d5lexg_:

Click to download the PDB-style file with coordinates for d5lexg_.
(The format of our PDB-style files is described here.)

Timeline for d5lexg_: