SCOP 1.63: Domain d1exma3: 1exm A:3-212

Lineage for d1exma3 (1exm A:3-212)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52629] (3 PDB entries)

8. Domain d1exma3: 1exm A:3-212 [32131]
   Other proteins in same PDB: d1exma1, d1exma2
   complexed with gnp, mg

Details for d1exma3

PDB Entry: 1exm, 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.

SCOP Domain Sequences for d1exma3:

Sequence; same for both SEQRES and ATOM records:

>d1exma3 c.37.1.8 (A:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

Timeline for d1exma3:

• d1exma3 first appeared (with stable ids) in SCOP 1.55
  
• d1exma3 appears in SCOP 1.61
  
• d1exma3 appears in SCOP 1.65
  
• d1exma3 appears in the current release, SCOPe 2.08