SCOPe 2.07: Domain d5jxef1: 5jxe F:1-110

Lineage for d5jxef1 (5jxe F:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5jxef1: 5jxe F:1-110 [321173]
   Other proteins in same PDB: d5jxea_, d5jxeb_, d5jxec2, d5jxef2
   automated match to d1dn0a1

Details for d5jxef1

PDB Entry: 5jxe, 2.9 Å

PDB Description: human pd-1 ectodomain complexed with pembrolizumab fab

PDB Compounds: (F:) Pembrolizumab Fab light chain

SCOPe Domain Sequences for d5jxef1:

Sequence; same for both SEQRES and ATOM records:

>d5jxef1 b.1.1.0 (F:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles
gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkvei

Timeline for d5jxef1:

• d5jxef1 first appeared in SCOPe 2.06
  
• d5jxef1 appears in the current release, SCOPe 2.08