SCOPe 2.07: Domain d5jxeb_: 5jxe B:

Lineage for d5jxeb_ (5jxe B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (9 PDB entries)

8. Domain d5jxeb_: 5jxe B: [321151]
   Other proteins in same PDB: d5jxec1, d5jxec2, d5jxef1, d5jxef2
   automated match to d4zqkb_

Details for d5jxeb_

PDB Entry: 5jxe, 2.9 Å

PDB Description: human pd-1 ectodomain complexed with pembrolizumab fab

PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d5jxeb_:

Sequence, based on SEQRES records:

>d5jxeb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrv

Sequence, based on observed residues (ATOM records):

>d5jxeb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfssfvlnwyrmqtdklaafpedrsqpgqdsrfrvtql
pngrdfhmsvvrarrndsgtylcgaislaqikeslraelrv

Timeline for d5jxeb_:

• d5jxeb_ first appeared in SCOPe 2.06
  
• d5jxeb_ appears in the current release, SCOPe 2.08