Lineage for d5lkea_ (5lke A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072014Protein beta-Lactoglobulin [50827] (4 species)
  7. 2072015Species Cow (Bos taurus) [TaxId:9913] [50828] (56 PDB entries)
    Uniprot P02754
  8. 2072073Domain d5lkea_: 5lke A: [321168]
    automated match to d1bsqa_
    complexed with myr

Details for d5lkea_

PDB Entry: 5lke (more details), 2.8 Å

PDB Description: bovine beta-lactoglobulin complex with myristic acid, ambient pressure
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d5lkea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lkea_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d5lkea_:

Click to download the PDB-style file with coordinates for d5lkea_.
(The format of our PDB-style files is described here.)

Timeline for d5lkea_: