Lineage for d1efcb3 (1efc B:8-204)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475344Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2475351Species Escherichia coli [TaxId:562] [52627] (11 PDB entries)
    Uniprot P02990
  8. 2475353Domain d1efcb3: 1efc B:8-204 [32114]
    Other proteins in same PDB: d1efca1, d1efca2, d1efcb1, d1efcb2
    complexed with gdp, mg

Details for d1efcb3

PDB Entry: 1efc (more details), 2.05 Å

PDB Description: intact elongation factor from e.coli
PDB Compounds: (B:) protein (elongation factor)

SCOPe Domain Sequences for d1efcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efcb3 c.37.1.8 (B:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

SCOPe Domain Coordinates for d1efcb3:

Click to download the PDB-style file with coordinates for d1efcb3.
(The format of our PDB-style files is described here.)

Timeline for d1efcb3: