SCOP 1.55: Domain d1efcb3: 1efc B:8-204

Lineage for d1efcb3 (1efc B:8-204)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)

8. Domain d1efcb3: 1efc B:8-204 [32114]
   Other proteins in same PDB: d1efca1, d1efca2, d1efcb1, d1efcb2

Details for d1efcb3

PDB Entry: 1efc, 2.05 Å

PDB Description: intact elongation factor from e.coli

SCOP Domain Sequences for d1efcb3:

Sequence; same for both SEQRES and ATOM records:

>d1efcb3 c.37.1.8 (B:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Timeline for d1efcb3:

• d1efcb3 appears in SCOP 1.57
  
• d1efcb3 appears in the current release, SCOPe 2.08