| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Escherichia coli [TaxId:562] [52627] (9 PDB entries) Uniprot P02990 |
| Domain d1efca3: 1efc A:8-204 [32113] Other proteins in same PDB: d1efca1, d1efca2, d1efcb1, d1efcb2 complexed with gdp, mg |
PDB Entry: 1efc (more details), 2.05 Å
SCOPe Domain Sequences for d1efca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efca3 c.37.1.8 (A:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper
Timeline for d1efca3: