Lineage for d1efcb2 (1efc B:297-393)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317760Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1317761Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1317789Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1317796Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)
    Uniprot P02990
  8. 1317798Domain d1efcb2: 1efc B:297-393 [25721]
    Other proteins in same PDB: d1efca1, d1efca3, d1efcb1, d1efcb3
    complexed with gdp, mg

Details for d1efcb2

PDB Entry: 1efc (more details), 2.05 Å

PDB Description: intact elongation factor from e.coli
PDB Compounds: (B:) protein (elongation factor)

SCOPe Domain Sequences for d1efcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efcb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d1efcb2:

Click to download the PDB-style file with coordinates for d1efcb2.
(The format of our PDB-style files is described here.)

Timeline for d1efcb2: