SCOPe 2.08: Domain d1efcb2: 1efc B:297-393

Lineage for d1efcb2 (1efc B:297-393)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
   Uniprot P02990

8. Domain d1efcb2: 1efc B:297-393 [25721]
   Other proteins in same PDB: d1efca1, d1efca3, d1efcb1, d1efcb3
   complexed with gdp, mg

Details for d1efcb2

PDB Entry: 1efc, 2.05 Å

PDB Description: intact elongation factor from e.coli

PDB Compounds: (B:) protein (elongation factor)

SCOPe Domain Sequences for d1efcb2:

Sequence; same for both SEQRES and ATOM records:

>d1efcb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d1efcb2:

• d1efcb2 first appeared (with stable ids) in SCOP 1.55
  
• d1efcb2 appears in SCOPe 2.07