Lineage for d1agrd2 (1agr D:11-60,D:182-354)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179695Protein Transducin (alpha subunit) [52623] (2 species)
  7. 179713Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)
  8. 179728Domain d1agrd2: 1agr D:11-60,D:182-354 [32112]
    Other proteins in same PDB: d1agra1, d1agrd1, d1agre_, d1agrh_

Details for d1agrd2

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

SCOP Domain Sequences for d1agrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agrd2 c.37.1.8 (D:11-60,D:182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
aaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethft
fkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklf
dsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedl
nkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

SCOP Domain Coordinates for d1agrd2:

Click to download the PDB-style file with coordinates for d1agrd2.
(The format of our PDB-style files is described here.)

Timeline for d1agrd2: