| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) ![]() |
| Family c.37.1.8: G proteins [52592] (26 proteins) |
| Protein Transducin (alpha subunit) [52623] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries) |
| Domain d1agrd2: 1agr D:11-60,D:182-354 [32112] Other proteins in same PDB: d1agra1, d1agrd1, d1agre_, d1agrh_ |
PDB Entry: 1agr (more details), 2.8 Å
SCOP Domain Sequences for d1agrd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agrd2 c.37.1.8 (D:11-60,D:182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
aaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethft
fkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklf
dsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedl
nkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
Timeline for d1agrd2:
View in 3DDomains from other chains: (mouse over for more information) d1agra1, d1agra2, d1agre_, d1agrh_ |