Lineage for d1agrh_ (1agr H:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154767Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
  4. 154768Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 154769Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 154783Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species)
  7. 154784Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 154786Domain d1agrh_: 1agr H: [18539]
    Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2

Details for d1agrh_

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

SCOP Domain Sequences for d1agrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agrh_ a.91.1.1 (H:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
aeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspkakkiynefi
svqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflksrfyl

SCOP Domain Coordinates for d1agrh_:

Click to download the PDB-style file with coordinates for d1agrh_.
(The format of our PDB-style files is described here.)

Timeline for d1agrh_: