SCOPe 2.08: Domain d5jhll2: 5jhl L:109-212

Lineage for d5jhll2 (5jhl L:109-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5jhll2: 5jhl L:109-212 [321083]
   Other proteins in same PDB: d5jhla1, d5jhla2, d5jhlh_, d5jhll1
   automated match to d1dqdl2

Details for d5jhll2

PDB Entry: 5jhl, 3 Å

PDB Description: crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody

PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d5jhll2:

Sequence; same for both SEQRES and ATOM records:

>d5jhll2 b.1.1.2 (L:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d5jhll2:

• d5jhll2 first appeared in SCOPe 2.06
  
• d5jhll2 appears in SCOPe 2.07