![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (621 PDB entries) |
![]() | Domain d5jhlh_: 5jhl H: [410230] Other proteins in same PDB: d5jhla1, d5jhla2, d5jhll1, d5jhll2 automated match to d6shgh_ |
PDB Entry: 5jhl (more details), 3 Å
SCOPe Domain Sequences for d5jhlh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhlh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vqlqqsgpelvkpgasvklscktsentfteytmhwvkqshgkslewiggidpnnggtnyn qkfkgkatltvdkssntaymelrsltsedsavyycgrrdyyaldywgqgtsvtvasaktt ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d5jhlh_:
![]() Domains from other chains: (mouse over for more information) d5jhla1, d5jhla2, d5jhll1, d5jhll2 |