![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [317280] (7 PDB entries) |
![]() | Domain d5jhla2: 5jhl A:304-403 [317281] Other proteins in same PDB: d5jhla1, d5jhlh_, d5jhll1, d5jhll2 automated match to d4gsxa2 |
PDB Entry: 5jhl (more details), 3 Å
SCOPe Domain Sequences for d5jhla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhla2 b.1.18.0 (A:304-403) automated matches {Zika virus [TaxId: 64320]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrs
Timeline for d5jhla2: