SCOPe 2.01: Domain d1fqka2: 1fqk A:28-60,A:182-345

Lineage for d1fqka2 (1fqk A:28-60,A:182-345)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries)
   Uniprot P10824

8. Domain d1fqka2: 1fqk A:28-60,A:182-345 [32103]
   Other proteins in same PDB: d1fqka1, d1fqkb_, d1fqkc1, d1fqkd_
   species chimera
   complexed with alf, gdp, mg

Details for d1fqka2

PDB Entry: 1fqk, 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

PDB Compounds: (A:) chimera of guanine nucleotide-binding protein g(t), alpha-1 subunit and guanine nucleotide-binding protein g(I), alpha-1 subunit

SCOPe Domain Sequences for d1fqka2:

Sequence; same for both SEQRES and ATOM records:

>d1fqka2 c.37.1.8 (A:28-60,A:182-345) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
vkfvfdavtdiiikenlk

Timeline for d1fqka2:

• d1fqka2 first appeared (with stable ids) in SCOP 1.55
  
• d1fqka2 appears in SCOP 1.75
  
• d1fqka2 appears in SCOPe 2.02
  
• d1fqka2 appears in the current release, SCOPe 2.08