SCOPe 2.07: Domain d5d1va_: 5d1v A:

Lineage for d5d1va_ (5d1v A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Chloroflexus aurantiacus [TaxId:324602] [320957] (1 PDB entry)

8. Domain d5d1va_: 5d1v A: [320958]
   automated match to d3aq5a_
   complexed with hem

Details for d5d1va_

PDB Entry: 5d1v, 1.74 Å

PDB Description: crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus

PDB Compounds: (A:) globin

SCOPe Domain Sequences for d5d1va_:

Sequence; same for both SEQRES and ATOM records:

>d5d1va_ a.1.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
eptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggprty
serrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqammn
r

Timeline for d5d1va_:

• d5d1va_ first appeared in SCOPe 2.06
  
• d5d1va_ appears in the current release, SCOPe 2.08