Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Chloroflexus aurantiacus [TaxId:324602] [320957] (1 PDB entry) |
Domain d5d1va_: 5d1v A: [320958] automated match to d3aq5a_ complexed with hem |
PDB Entry: 5d1v (more details), 1.74 Å
SCOPe Domain Sequences for d5d1va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d1va_ a.1.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]} eptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggprty serrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqammn r
Timeline for d5d1va_: