Lineage for d5d1va_ (5d1v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689412Species Chloroflexus aurantiacus [TaxId:324602] [320957] (1 PDB entry)
  8. 2689413Domain d5d1va_: 5d1v A: [320958]
    automated match to d3aq5a_
    complexed with hem

Details for d5d1va_

PDB Entry: 5d1v (more details), 1.74 Å

PDB Description: crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus
PDB Compounds: (A:) globin

SCOPe Domain Sequences for d5d1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d1va_ a.1.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
eptiyeqiggeatfrrivdifyarveadprlrhlfpadlepgkehqrlflmqyfggprty
serrghprlrmrhapfpigprerdawlehmlaalneagvpeparsvmenyfrhaaqammn
r

SCOPe Domain Coordinates for d5d1va_:

Click to download the PDB-style file with coordinates for d5d1va_.
(The format of our PDB-style files is described here.)

Timeline for d5d1va_: