| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes  | 
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies  | 
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest  | 
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain  | 
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries) Uniprot P10824  | 
| Domain d1as0a2: 1as0 A:32-60,A:182-344 [32095] Other proteins in same PDB: d1as0a1 complexed with gsp, mg, so4  | 
PDB Entry: 1as0 (more details), 2 Å
SCOPe Domain Sequences for d1as0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1as0a2 c.37.1.8 (A:32-60,A:182-344) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgavesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdvii
Timeline for d1as0a2: