Lineage for d1as0a2 (1as0 A:32-60,A:182-344)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164431Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1164475Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 1164480Domain d1as0a2: 1as0 A:32-60,A:182-344 [32095]
    Other proteins in same PDB: d1as0a1
    complexed with gsp, mg, so4

Details for d1as0a2

PDB Entry: 1as0 (more details), 2 Å

PDB Description: gtp-gamma-s bound g42v gia1
PDB Compounds: (A:) gia1

SCOPe Domain Sequences for d1as0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as0a2 c.37.1.8 (A:32-60,A:182-344) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgavesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdvii

SCOPe Domain Coordinates for d1as0a2:

Click to download the PDB-style file with coordinates for d1as0a2.
(The format of our PDB-style files is described here.)

Timeline for d1as0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1as0a1