SCOP 1.67: Domain d1cjkc2: 1cjk C:39-65,C:202-388

Lineage for d1cjkc2 (1cjk C:39-65,C:202-388)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1cjkc2: 1cjk C:39-65,C:202-388 [32092]
   Other proteins in same PDB: d1cjka_, d1cjkb_, d1cjkc1
   complexed with ags, cl, fok, gsp, mes, mg, mn; mutant

Details for d1cjkc2

PDB Entry: 1cjk, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn

SCOP Domain Sequences for d1cjkc2:

Sequence; same for both SEQRES and ATOM records:

>d1cjkc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1cjkc2:

• d1cjkc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjkc2 appears in SCOP 1.65
  
• d1cjkc2 appears in SCOP 1.69
  
• d1cjkc2 appears in the current release, SCOPe 2.08