SCOP 1.55: Domain d1cjkc2: 1cjk C:39-65,C:202-388

Lineage for d1cjkc2 (1cjk C:39-65,C:202-388)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1cjkc2: 1cjk C:39-65,C:202-388 [32092]
   Other proteins in same PDB: d1cjka_, d1cjkb_, d1cjkc1

Details for d1cjkc2

PDB Entry: 1cjk, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn

SCOP Domain Sequences for d1cjkc2:

Sequence; same for both SEQRES and ATOM records:

>d1cjkc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1cjkc2:

• d1cjkc2 appears in SCOP 1.57
  
• d1cjkc2 appears in the current release, SCOPe 2.08