SCOP 1.57: Domain d1cjtc2: 1cjt C:39-65,C:202-388

Lineage for d1cjtc2 (1cjt C:39-65,C:202-388)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1cjtc2: 1cjt C:39-65,C:202-388 [32089]
   Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc1

Details for d1cjtc2

PDB Entry: 1cjt, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg

SCOP Domain Sequences for d1cjtc2:

Sequence; same for both SEQRES and ATOM records:

>d1cjtc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1cjtc2:

• d1cjtc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjtc2 appears in SCOP 1.59
  
• d1cjtc2 appears in the current release, SCOPe 2.08