Lineage for d1cjtc2 (1cjt C:39-65,C:202-388)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
    Uniprot P04896 39-388
  8. Domain d1cjtc2: 1cjt C:39-65,C:202-388 [32089]
    Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc1
    complexed with cl, dad, fok, gsp, mes, mg, mn

Details for d1cjtc2

PDB Entry: 1cjt (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg
PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cjtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjtc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

SCOPe Domain Coordinates for d1cjtc2 are not available.

Timeline for d1cjtc2:

Domains from same chain:
(mouse over for more information)
d1cjtc1
Domains from other chains:
(mouse over for more information)
d1cjta_, d1cjtb_