Lineage for d1cjtc2 (1cjt C:39-65,C:202-388)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23317Protein Transducin (alpha subunit) [52623] (2 species)
  7. 23318Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 23331Domain d1cjtc2: 1cjt C:39-65,C:202-388 [32089]
    Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc1

Details for d1cjtc2

PDB Entry: 1cjt (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg

SCOP Domain Sequences for d1cjtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjtc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

SCOP Domain Coordinates for d1cjtc2:

Click to download the PDB-style file with coordinates for d1cjtc2.
(The format of our PDB-style files is described here.)

Timeline for d1cjtc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjtc1