SCOPe 2.01: Domain d1cs4c2: 1cs4 C:39-65,C:202-388

Lineage for d1cs4c2 (1cs4 C:39-65,C:202-388)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries)
   Uniprot P04896 39-388

8. Domain d1cs4c2: 1cs4 C:39-65,C:202-388 [32088]
   Other proteins in same PDB: d1cs4a_, d1cs4b_, d1cs4c1
   complexed with 101, cl, fok, gsp, mes, mg, pop

Details for d1cs4c2

PDB Entry: 1cs4, 2.5 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cs4c2:

Sequence, based on SEQRES records:

>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Sequence, based on observed residues (ATOM records):

>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrml

Timeline for d1cs4c2:

• d1cs4c2 first appeared (with stable ids) in SCOP 1.55
  
• d1cs4c2 appears in SCOP 1.75
  
• d1cs4c2 appears in SCOPe 2.02
  
• d1cs4c2 appears in the current release, SCOPe 2.08