Lineage for d1cs4c2 (1cs4 C:39-65,C:202-388)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243198Family c.37.1.8: G proteins [52592] (31 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 243499Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 243500Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 243512Domain d1cs4c2: 1cs4 C:39-65,C:202-388 [32088]
    Other proteins in same PDB: d1cs4a_, d1cs4b_, d1cs4c1
    complexed with 101, cl, fok, gsp, mes, mg, pop; mutant

Details for d1cs4c2

PDB Entry: 1cs4 (more details), 2.5 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg

SCOP Domain Sequences for d1cs4c2:

Sequence, based on SEQRES records: (download)

>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Sequence, based on observed residues (ATOM records): (download)

>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrml

SCOP Domain Coordinates for d1cs4c2:

Click to download the PDB-style file with coordinates for d1cs4c2.
(The format of our PDB-style files is described here.)

Timeline for d1cs4c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cs4c1