SCOP 1.61: Domain d1culc2: 1cul C:39-65,C:202-386

Lineage for d1culc2 (1cul C:39-65,C:202-386)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.8: G proteins [52592] (26 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1culc2: 1cul C:39-65,C:202-386 [32087]
   Other proteins in same PDB: d1cula_, d1culb_, d1culc1

Details for d1culc2

PDB Entry: 1cul, 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg

SCOP Domain Sequences for d1culc2:

Sequence; same for both SEQRES and ATOM records:

>d1culc2 c.37.1.8 (C:39-65,C:202-386) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrm

Timeline for d1culc2:

• d1culc2 first appeared (with stable ids) in SCOP 1.55
  
• d1culc2 appears in SCOP 1.59
  
• d1culc2 appears in SCOP 1.63
  
• d1culc2 appears in the current release, SCOPe 2.08