SCOP 1.61: Domain d1tndc2: 1tnd C:27-56,C:178-342

Lineage for d1tndc2 (1tnd C:27-56,C:178-342)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.8: G proteins [52592] (26 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1tndc2: 1tnd C:27-56,C:178-342 [32083]
   Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1

Details for d1tndc2

PDB Entry: 1tnd, 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s

SCOP Domain Sequences for d1tndc2:

Sequence; same for both SEQRES and ATOM records:

>d1tndc2 c.37.1.8 (C:27-56,C:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

Timeline for d1tndc2:

• d1tndc2 first appeared (with stable ids) in SCOP 1.55
  
• d1tndc2 appears in SCOP 1.59
  
• d1tndc2 appears in SCOP 1.63
  
• d1tndc2 appears in the current release, SCOPe 2.08