| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (37 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
| Domain d1tnda2: 1tnd A:27-56,A:178-349 [32081] Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1 |
PDB Entry: 1tnd (more details), 2.2 Å
SCOP Domain Sequences for d1tnda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnda2 c.37.1.8 (A:27-56,A:178-349) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiikenlkdcgl
Timeline for d1tnda2:
View in 3DDomains from other chains: (mouse over for more information) d1tndb1, d1tndb2, d1tndc1, d1tndc2 |