| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
| Domain d1tag_2: 1tag 27-56,178-340 [32080] Other proteins in same PDB: d1tag_1 |
PDB Entry: 1tag (more details), 1.8 Å
SCOP Domain Sequences for d1tag_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tag_2 c.37.1.8 (27-56,178-340) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiii
Timeline for d1tag_2: