SCOP 1.69: Domain d1tag_1: 1tag 57-177

Lineage for d1tag_1 (1tag 57-177)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries)

8. Domain d1tag_1: 1tag 57-177 [18197]
   Other proteins in same PDB: d1tag_2

Details for d1tag_1

PDB Entry: 1tag, 1.8 Å

PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein

SCOP Domain Sequences for d1tag_1:

Sequence; same for both SEQRES and ATOM records:

>d1tag_1 a.66.1.1 (57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

Timeline for d1tag_1:

• d1tag_1 first appeared (with stable ids) in SCOP 1.55
  
• d1tag_1 appears in SCOP 1.67
  
• d1tag_1 appears in SCOP 1.71
  
• d1tag_1 appears in the current release, SCOPe 2.08, called d1taga1